Brand: | Abnova |
Reference: | H00001020-D01 |
Product name: | CDK5 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDK5 protein. |
Gene id: | 1020 |
Gene name: | CDK5 |
Gene alias: | PSSALRE |
Gene description: | cyclin-dependent kinase 5 |
Genbank accession: | NM_004935.2 |
Immunogen: | CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
Protein accession: | NP_004926.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDK5 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDK5 expression in HeLa. |
Applications: | WB-Ce,WB-Tr,IP |
Shipping condition: | Dry Ice |