CDK5 MaxPab rabbit polyclonal antibody (D01) View larger

CDK5 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK5 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr,IP

More info about CDK5 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00001020-D01
Product name: CDK5 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CDK5 protein.
Gene id: 1020
Gene name: CDK5
Gene alias: PSSALRE
Gene description: cyclin-dependent kinase 5
Genbank accession: NM_004935.2
Immunogen: CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Protein accession: NP_004926.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001020-D01-1-1-1.jpg
Application image note: CDK5 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDK5 expression in HeLa.
Applications: WB-Ce,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CDK5 MaxPab rabbit polyclonal antibody (D01) now

Add to cart