| Brand: | Abnova |
| Reference: | H00001019-M06 |
| Product name: | CDK4 monoclonal antibody (M06), clone 6D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK4. |
| Clone: | 6D7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1019 |
| Gene name: | CDK4 |
| Gene alias: | CMM3|MGC14458|PSK-J3 |
| Gene description: | cyclin-dependent kinase 4 |
| Genbank accession: | BC003644 |
| Immunogen: | CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Protein accession: | AAH03644 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | CDK4 monoclonal antibody (M06), clone 6D7 Western Blot analysis of CDK4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |