| Brand: | Abnova |
| Reference: | H00001018-M01 |
| Product name: | CDK3 monoclonal antibody (M01), clone 3C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK3. |
| Clone: | 3C12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1018 |
| Gene name: | CDK3 |
| Gene alias: | - |
| Gene description: | cyclin-dependent kinase 3 |
| Genbank accession: | NM_001258 |
| Immunogen: | CDK3 (NP_001249, 206 a.a. ~ 305 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH |
| Protein accession: | NP_001249 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | HuR promotes breast cancer cell proliferation and survival via binding to CDK3 mRNA.Zhang Z, Huang A, Zhang A, Zhou C. Biomed Pharmacother. 2017 May 10;91:788-795. |