| Brand: | Abnova |
| Reference: | H00001015-M03 |
| Product name: | CDH17 monoclonal antibody (M03), clone 3H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH17. |
| Clone: | 3H2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1015 |
| Gene name: | CDH17 |
| Gene alias: | CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024 |
| Gene description: | cadherin 17, LI cadherin (liver-intestine) |
| Genbank accession: | NM_004063 |
| Immunogen: | CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY |
| Protein accession: | NP_004054 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The contribution of cell phenotype to the behavior of gastric cancer.Solcia E, Klersy C, Vanoli A, Grillo F, Manca R, Tava F, Luinetti O, Fiocca R. Gastric Cancer. 2013 Jan 18. [Epub ahead of print] |