No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001015-M01 |
Product name: | CDH17 monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH17. |
Clone: | 1H3 |
Isotype: | IgG1 Kappa |
Gene id: | 1015 |
Gene name: | CDH17 |
Gene alias: | CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024 |
Gene description: | cadherin 17, LI cadherin (liver-intestine) |
Genbank accession: | NM_004063 |
Immunogen: | CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY |
Protein accession: | NP_004054 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CDH17 monoclonal antibody (M01), clone 1H3. Western Blot analysis of CDH17 expression in human intestinal wall. |
Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system.Su MC, Yuan RH, Lin CY, Jeng YM. Mod Pathol. 2008 Nov;21(11):1379-86. Epub 2008 Jun 13. |