| Brand: | Abnova |
| Reference: | H00001009-A01 |
| Product name: | CDH11 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDH11. |
| Gene id: | 1009 |
| Gene name: | CDH11 |
| Gene alias: | CAD11|CDHOB|OB|OSF-4 |
| Gene description: | cadherin 11, type 2, OB-cadherin (osteoblast) |
| Genbank accession: | NM_001797 |
| Immunogen: | CDH11 (NP_001788, 509 a.a. ~ 617 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST |
| Protein accession: | NP_001788 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDH11 polyclonal antibody (A01), Lot # 051121JC01 Western Blot analysis of CDH11 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |