| Brand: | Abnova |
| Reference: | H00000999-A01 |
| Product name: | CDH1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDH1. |
| Gene id: | 999 |
| Gene name: | CDH1 |
| Gene alias: | Arc-1|CD324|CDHE|ECAD|LCAM|UVO |
| Gene description: | cadherin 1, type 1, E-cadherin (epithelial) |
| Genbank accession: | NM_004360 |
| Immunogen: | CDH1 (ENSP00000261769, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV |
| Protein accession: | ENSP00000261769 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |