Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC25C monoclonal antibody (M01A), clone 3B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about CDC25C monoclonal antibody (M01A), clone 3B11
| Brand: | Abnova |
| Reference: | H00000995-M01A |
| Product name: | CDC25C monoclonal antibody (M01A), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC25C. |
| Clone: | 3B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 995 |
| Gene name: | CDC25C |
| Gene alias: | CDC25 |
| Gene description: | cell division cycle 25 homolog C (S. pombe) |
| Genbank accession: | BC019089 |
| Immunogen: | CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST |
| Protein accession: | AAH19089 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDC25C monoclonal antibody (M01A), clone 3B11 Western Blot analysis of CDC25C expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |