Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC5L polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CDC5L polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000988-A01 |
| Product name: | CDC5L polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDC5L. |
| Gene id: | 988 |
| Gene name: | CDC5L |
| Gene alias: | CEF1|KIAA0432|PCDC5RP|dJ319D22.1|hCDC5 |
| Gene description: | CDC5 cell division cycle 5-like (S. pombe) |
| Genbank accession: | NM_001253 |
| Immunogen: | CDC5L (NP_001244, 719 a.a. ~ 802 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF |
| Protein accession: | NP_001244 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDC5L polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of CDC5L expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |