Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC2 monoclonal antibody (M02), clone 1C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about CDC2 monoclonal antibody (M02), clone 1C7
| Brand: | Abnova |
| Reference: | H00000983-M02 |
| Product name: | CDC2 monoclonal antibody (M02), clone 1C7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CDC2. |
| Clone: | 1C7 |
| Isotype: | IgG1 kappa |
| Gene id: | 983 |
| Gene name: | CDC2 |
| Gene alias: | CDC28A|CDK1|DKFZp686L20222|MGC111195 |
| Gene description: | cell division cycle 2, G1 to S and G2 to M |
| Genbank accession: | BC014563 |
| Immunogen: | CDC2 (AAH14563, 211 a.a. ~ 297 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
| Protein accession: | AAH14563 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |