No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000983-A01 |
| Product name: | CDC2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDC2. |
| Gene id: | 983 |
| Gene name: | CDC2 |
| Gene alias: | CDC28A|CDK1|DKFZp686L20222|MGC111195 |
| Gene description: | cell division cycle 2, G1 to S and G2 to M |
| Genbank accession: | BC014563 |
| Immunogen: | CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
| Protein accession: | AAH14563 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |