CD81 (Human) Recombinant Protein (Q01) View larger

CD81 (Human) Recombinant Protein (Q01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD81 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CD81 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00000975-Q01
Product name: CD81 (Human) Recombinant Protein (Q01)
Product description: Human CD81 partial ORF ( AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 975
Gene name: CD81
Gene alias: S5.7|TAPA1|TSPAN28
Gene description: CD81 molecule
Genbank accession: BC002978
Immunogen sequence/protein sequence: GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Protein accession: AAH02978
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000975-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Tetraspanins displayed in retrovirus-derived virus-like particles and their immunogenicity.Soares HR, Castro R, Tomas HA, Rodrigues AF, Gomes-Alves P, Bellier B, Klatzmann D, Carrondo M3, Alves PM, Coroadinha AS.
Vaccine. 2016 Mar 18;34(13):1634-41.

Reviews

Buy CD81 (Human) Recombinant Protein (Q01) now

Add to cart