View larger

CD74 monoclonal antibody (M02), clone 2F8

Reference:

Condition: New product

Data sheet of CD74 monoclonal antibody (M02), clone 2F8

Brand:	Abnova
Reference:	H00000972-M02
Product name:	CD74 monoclonal antibody (M02), clone 2F8
Product description:	Mouse monoclonal antibody raised against a full-length recombinant CD74.
Clone:	2F8
Isotype:	IgG2a Kappa
Gene id:	972
Gene name:	CD74
Gene alias:	DHLAG\|HLADG\|Ia-GAMMA
Gene description:	CD74 molecule, major histocompatibility complex, class II invariant chain
Genbank accession:	BC024272
Immunogen:	CD74 (AAH24272, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Protein accession:	AAH24272
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged CD74 is 1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice