| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00000966-B05P |
| Product name: | CD59 purified MaxPab mouse polyclonal antibody (B05P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CD59 protein. |
| Gene id: | 966 |
| Gene name: | CD59 |
| Gene alias: | 16.3A5|1F5|EJ16|EJ30|EL32|FLJ38134|FLJ92039|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MGC2354|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20 |
| Gene description: | CD59 molecule, complement regulatory protein |
| Genbank accession: | BC001506 |
| Immunogen: | CD59 (AAH01506, 1 a.a. ~ 128 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
| Protein accession: | AAH01506 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CD59 expression in transfected 293T cell line (H00000966-T07) by CD59 MaxPab polyclonal antibody. Lane 1: CD59 transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |