Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD48 monoclonal antibody (M01), clone 3B8-2C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about CD48 monoclonal antibody (M01), clone 3B8-2C2
| Brand: | Abnova |
| Reference: | H00000962-M01 |
| Product name: | CD48 monoclonal antibody (M01), clone 3B8-2C2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CD48. |
| Clone: | 3B8-2C2 |
| Isotype: | IgG2a kappa |
| Gene id: | 962 |
| Gene name: | CD48 |
| Gene alias: | BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48 |
| Gene description: | CD48 molecule |
| Genbank accession: | BC030224 |
| Immunogen: | CD48 (AAH30224, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV |
| Protein accession: | AAH30224 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CD48 on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 2 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |