CD48 monoclonal antibody (M01), clone 3B8-2C2 View larger

CD48 monoclonal antibody (M01), clone 3B8-2C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD48 monoclonal antibody (M01), clone 3B8-2C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about CD48 monoclonal antibody (M01), clone 3B8-2C2

Brand: Abnova
Reference: H00000962-M01
Product name: CD48 monoclonal antibody (M01), clone 3B8-2C2
Product description: Mouse monoclonal antibody raised against a full length recombinant CD48.
Clone: 3B8-2C2
Isotype: IgG2a kappa
Gene id: 962
Gene name: CD48
Gene alias: BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48
Gene description: CD48 molecule
Genbank accession: BC030224
Immunogen: CD48 (AAH30224, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV
Protein accession: AAH30224
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000962-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000962-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CD48 on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 2 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD48 monoclonal antibody (M01), clone 3B8-2C2 now

Add to cart