| Brand: | Abnova |
| Reference: | H00000962-A01 |
| Product name: | CD48 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant CD48. |
| Gene id: | 962 |
| Gene name: | CD48 |
| Gene alias: | BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48 |
| Gene description: | CD48 molecule |
| Genbank accession: | BC030224 |
| Immunogen: | CD48 (AAH30224, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV |
| Protein accession: | AAH30224 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |