View larger

CD40 monoclonal antibody (M33), clone 4G15

Reference:

Condition: New product

Data sheet of CD40 monoclonal antibody (M33), clone 4G15

Brand:	Abnova
Reference:	H00000958-M33
Product name:	CD40 monoclonal antibody (M33), clone 4G15
Product description:	Mouse monoclonal antibody raised against a partial recombinant CD40.
Clone:	4G15
Isotype:	IgG1 Kappa
Gene id:	958
Gene name:	CD40
Gene alias:	Bp50\|CDW40\|MGC9013\|TNFRSF5\|p50
Gene description:	CD40 molecule, TNF receptor superfamily member 5
Genbank accession:	BC012419
Immunogen:	CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein.
Immunogen sequence/protein sequence:	EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Protein accession:	AAH12419
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunofluorescence of monoclonal antibody to CD40 on HeLa cell . [antibody concentration 10 ug/ml]
Applications:	IF,ELISA
Shipping condition:	Dry Ice