No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
| Brand: | Abnova |
| Reference: | H00000958-M33 |
| Product name: | CD40 monoclonal antibody (M33), clone 4G15 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD40. |
| Clone: | 4G15 |
| Isotype: | IgG1 Kappa |
| Gene id: | 958 |
| Gene name: | CD40 |
| Gene alias: | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene description: | CD40 molecule, TNF receptor superfamily member 5 |
| Genbank accession: | BC012419 |
| Immunogen: | CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Protein accession: | AAH12419 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to CD40 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |