Brand: | Abnova |
Reference: | H00000958-M29 |
Product name: | CD40 monoclonal antibody (M29), clone 5G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD40. |
Clone: | 5G10 |
Isotype: | IgG1 Kappa |
Gene id: | 958 |
Gene name: | CD40 |
Gene alias: | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
Gene description: | CD40 molecule, TNF receptor superfamily member 5 |
Genbank accession: | BC012419 |
Immunogen: | CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Protein accession: | AAH12419 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to CD40 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |