> >>CD40 monoclonal antibody (M22), clone 4G3
CD40 monoclonal antibody (M22), clone 4G3 View larger

CD40 monoclonal antibody (M22), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of CD40 monoclonal antibody (M22), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CD40 monoclonal antibody (M22), clone 4G3

Brand: Abnova
Reference: H00000958-M22
Product name: CD40 monoclonal antibody (M22), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant CD40.
Clone: 4G3
Isotype: IgG2a Kappa
Gene id: 958
Gene name: CD40
Gene alias: Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene description: CD40 molecule, TNF receptor superfamily member 5
Genbank accession: BC012419
Immunogen: CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Protein accession: AAH12419
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000958-M22-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (23.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD40 monoclonal antibody (M22), clone 4G3 now

Add to cart