CD40 monoclonal antibody (M20), clone 3G10 View larger

CD40 monoclonal antibody (M20), clone 3G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD40 monoclonal antibody (M20), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CD40 monoclonal antibody (M20), clone 3G10

Brand: Abnova
Reference: H00000958-M20
Product name: CD40 monoclonal antibody (M20), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant CD40.
Clone: 3G10
Isotype: IgG1 Kappa
Gene id: 958
Gene name: CD40
Gene alias: Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene description: CD40 molecule, TNF receptor superfamily member 5
Genbank accession: BC012419
Immunogen: CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Protein accession: AAH12419
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CD40 monoclonal antibody (M20), clone 3G10 now

Add to cart