| Brand: | Abnova |
| Reference: | H00000958-K04 |
| Product name: | CD40 monoclonal antibody (K04), clone 3D4 |
| Product description: | Rabbit monoclonal antibody raised against a partial recombinant CD40. |
| Clone: | 3D4 |
| Gene id: | 958 |
| Gene name: | CD40 |
| Gene alias: | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene description: | CD40 molecule, TNF receptor superfamily member 5 |
| Genbank accession: | BC012419.1 |
| Immunogen: | Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
| Immunogen sequence/protein sequence: | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Protein accession: | AAH12419.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (22.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |