CD40 monoclonal antibody (K04), clone 3D4 View larger

CD40 monoclonal antibody (K04), clone 3D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD40 monoclonal antibody (K04), clone 3D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsELISA,WB-Re

More info about CD40 monoclonal antibody (K04), clone 3D4

Brand: Abnova
Reference: H00000958-K04
Product name: CD40 monoclonal antibody (K04), clone 3D4
Product description: Rabbit monoclonal antibody raised against a partial recombinant CD40.
Clone: 3D4
Gene id: 958
Gene name: CD40
Gene alias: Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene description: CD40 molecule, TNF receptor superfamily member 5
Genbank accession: BC012419.1
Immunogen: Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Immunogen sequence/protein sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Protein accession: AAH12419.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000958-K04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (22.11 KDa) .
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD40 monoclonal antibody (K04), clone 3D4 now

Add to cart