Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ENTPD5 monoclonal antibody (M07), clone 4A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about ENTPD5 monoclonal antibody (M07), clone 4A5
| Brand: | Abnova |
| Reference: | H00000957-M07 |
| Product name: | ENTPD5 monoclonal antibody (M07), clone 4A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ENTPD5. |
| Clone: | 4A5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 957 |
| Gene name: | ENTPD5 |
| Gene alias: | CD39L4|MGC163357|MGC163359|NTPDase-5|PCPH |
| Gene description: | ectonucleoside triphosphate diphosphohydrolase 5 |
| Genbank accession: | NM_001249 |
| Immunogen: | ENTPD5 (NP_001240, 319 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ |
| Protein accession: | NP_001240 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ENTPD5 monoclonal antibody (M07), clone 4A5 Western Blot analysis of ENTPD5 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |