ENTPD3 monoclonal antibody (M01), clone 3E8 View larger

ENTPD3 monoclonal antibody (M01), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ENTPD3 monoclonal antibody (M01), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ENTPD3 monoclonal antibody (M01), clone 3E8

Brand: Abnova
Reference: H00000956-M01
Product name: ENTPD3 monoclonal antibody (M01), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant ENTPD3.
Clone: 3E8
Isotype: IgG2a Kappa
Gene id: 956
Gene name: ENTPD3
Gene alias: CD39L3|FLJ93839|HB6|NTPDase-3
Gene description: ectonucleoside triphosphate diphosphohydrolase 3
Genbank accession: NM_001248
Immunogen: ENTPD3 (NP_001239, 107 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG
Protein accession: NP_001239
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000956-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ENTPD3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ENTPD3 monoclonal antibody (M01), clone 3E8 now

Add to cart