| Brand:  | Abnova | 
| Reference:  | H00000955-M03 | 
| Product name:  | ENTPD6 monoclonal antibody (M03), clone 2D10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant ENTPD6. | 
| Clone:  | 2D10 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 955 | 
| Gene name:  | ENTPD6 | 
| Gene alias:  | CD39L2|DKFZp781G2277|DKFZp781K21102|FLJ36711|IL-6SAG|IL6ST2|NTPDase-6|dJ738P15.3 | 
| Gene description:  | ectonucleoside triphosphate diphosphohydrolase 6 (putative function) | 
| Genbank accession:  | NM_001247 | 
| Immunogen:  | ENTPD6 (NP_001238, 386 a.a. ~ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS | 
| Protein accession:  | NP_001238 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to ENTPD6 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] | 
| Applications:  | IHC-P,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |