Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 749,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 749,00 €
Data sheet of CD38 monoclonal antibody (M02), clone 4G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about CD38 monoclonal antibody (M02), clone 4G3
| Brand: | Abnova |
| Reference: | H00000952-M02 |
| Product name: | CD38 monoclonal antibody (M02), clone 4G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD38. |
| Clone: | 4G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 952 |
| Gene name: | CD38 |
| Gene alias: | T10 |
| Gene description: | CD38 molecule |
| Genbank accession: | BC007964 |
| Immunogen: | CD38 (AAH07964, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI |
| Protein accession: | AAH07964 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CD38 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |