| Brand: | Abnova |
| Reference: | H00000950-M01 |
| Product name: | SCARB2 monoclonal antibody (M01), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCARB2. |
| Clone: | 1C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 950 |
| Gene name: | SCARB2 |
| Gene alias: | AMRF|CD36L2|HLGP85|LIMPII|SR-BII |
| Gene description: | scavenger receptor class B, member 2 |
| Genbank accession: | NM_005506 |
| Immunogen: | SCARB2 (NP_005497, 339 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN |
| Protein accession: | NP_005497 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SCARB2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |