| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000950-A01 |
| Product name: | SCARB2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SCARB2. |
| Gene id: | 950 |
| Gene name: | SCARB2 |
| Gene alias: | AMRF|CD36L2|HLGP85|LIMPII|SR-BII |
| Gene description: | scavenger receptor class B, member 2 |
| Genbank accession: | NM_005506 |
| Immunogen: | SCARB2 (NP_005497, 339 a.a. ~ 437 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN |
| Protein accession: | NP_005497 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SCARB2 expression in transfected 293T cell line by SCARB2 polyclonal antibody (A01). Lane1:SCARB2 transfected lysate(54.159 KDa). Lane2:Non-transfected lysate. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |