| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00000946-M02 |
| Product name: | SIGLEC6 monoclonal antibody (M02), clone 2G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIGLEC6. |
| Clone: | 2G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 946 |
| Gene name: | SIGLEC6 |
| Gene alias: | CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6 |
| Gene description: | sialic acid binding Ig-like lectin 6 |
| Genbank accession: | NM_001245 |
| Immunogen: | SIGLEC6 (NP_001236, 371 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| Protein accession: | NP_001236 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 monoclonal antibody (M02), clone 2G6. Lane 1: SIGLEC6 transfected lysate(48.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |