Cart 16 Product Products 5 508,78 € (empty)
No products
To be determined Shipping
5 508,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 16 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 508,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 508,78 €
Data sheet of SIGLEC6 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr,IP |
More info about SIGLEC6 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00000946-D01 |
| Product name: | SIGLEC6 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SIGLEC6 protein. |
| Gene id: | 946 |
| Gene name: | SIGLEC6 |
| Gene alias: | CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6 |
| Gene description: | sialic acid binding Ig-like lectin 6 |
| Genbank accession: | ENST00000346477 |
| Immunogen: | SIGLEC6 (ENSP00000344064, 1 a.a. ~ 437 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| Protein accession: | ENSP00000344064 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SIGLEC6 MaxPab rabbit polyclonal antibody. Western Blot analysis of SIGLEC6 expression in A-431. |
| Applications: | WB-Ce,WB-Tr,IP |
| Shipping condition: | Dry Ice |