Brand: | Abnova |
Reference: | H00000944-M09 |
Product name: | TNFSF8 monoclonal antibody (M09), clone 4E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF8. |
Clone: | 4E6 |
Isotype: | IgG1 Kappa |
Gene id: | 944 |
Gene name: | TNFSF8 |
Gene alias: | CD153|CD30L|CD30LG|MGC138144 |
Gene description: | tumor necrosis factor (ligand) superfamily, member 8 |
Genbank accession: | BC093630.1 |
Immunogen: | TNFSF8 (AAH93630.1, 63 a.a. ~ 234 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Protein accession: | AAH93630.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |