Cart 40 Product Products 26 543,09 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 40 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 26 543,09 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 26 808,09 €
Data sheet of TNFSF8 monoclonal antibody (M08), clone 4A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNFSF8 monoclonal antibody (M08), clone 4A9
| Brand: | Abnova |
| Reference: | H00000944-M08 |
| Product name: | TNFSF8 monoclonal antibody (M08), clone 4A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF8. |
| Clone: | 4A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 944 |
| Gene name: | TNFSF8 |
| Gene alias: | CD153|CD30L|CD30LG|MGC138144 |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 8 |
| Genbank accession: | BC093630.1 |
| Immunogen: | TNFSF8 (AAH93630.1, 63 a.a. ~ 234 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Protein accession: | AAH93630.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |