Cart 10 Product Products 2 075,52 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 10 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 075,52 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 075,52 €
Data sheet of TNFSF8 monoclonal antibody (M01A), clone 2E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about TNFSF8 monoclonal antibody (M01A), clone 2E11
| Brand: | Abnova |
| Reference: | H00000944-M01A |
| Product name: | TNFSF8 monoclonal antibody (M01A), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF8. |
| Clone: | 2E11 |
| Isotype: | IgM Kappa |
| Gene id: | 944 |
| Gene name: | TNFSF8 |
| Gene alias: | CD153|CD30L|CD30LG|MGC138144 |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 8 |
| Genbank accession: | NM_001244 |
| Immunogen: | TNFSF8 (NP_001235, 153 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Protein accession: | NP_001235 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TNFSF8 expression in transfected 293T cell line by TNFSF8 monoclonal antibody (M01A), clone 2E11. Lane 1: TNFSF8 transfected lysate (Predicted MW: 26 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |