Cart 30 Product Products 4 210,64 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x 4E-BP1...259,07 € -
-
1 x Olfactory...259,07 € -
No products
To be determined Shipping
4 210,64 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 30 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 210,64 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 210,64 €
Data sheet of TNFSF8 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TNFSF8 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000944-A01 |
| Product name: | TNFSF8 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TNFSF8. |
| Gene id: | 944 |
| Gene name: | TNFSF8 |
| Gene alias: | CD153|CD30L|CD30LG|MGC138144 |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 8 |
| Genbank accession: | NM_001244 |
| Immunogen: | TNFSF8 (NP_001235, 153 a.a. ~ 234 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Protein accession: | NP_001235 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |