Cart 2 Product Products 664,00 € (empty)
No products
To be determined Shipping
664,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 664,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 664,00 €
Data sheet of TNFRSF8 monoclonal antibody (M02), clone 4C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TNFRSF8 monoclonal antibody (M02), clone 4C9
| Brand: | Abnova |
| Reference: | H00000943-M02 |
| Product name: | TNFRSF8 monoclonal antibody (M02), clone 4C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF8. |
| Clone: | 4C9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 943 |
| Gene name: | TNFRSF8 |
| Gene alias: | CD30|D1S166E|KI-1 |
| Gene description: | tumor necrosis factor receptor superfamily, member 8 |
| Genbank accession: | NM_001243 |
| Immunogen: | TNFRSF8 (NP_001234, 21 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA |
| Protein accession: | NP_001234 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.17 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |