No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00000942-M11 | 
| Product name: | CD86 monoclonal antibody (M11), clone 3F2 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD86. | 
| Clone: | 3F2 | 
| Isotype: | IgG1 Kappa | 
| Gene id: | 942 | 
| Gene name: | CD86 | 
| Gene alias: | B7-2|B70|CD28LG2|LAB72|MGC34413 | 
| Gene description: | CD86 molecule | 
| Genbank accession: | BC040261.1 | 
| Immunogen: | CD86 (AAH40261.1, 24 a.a. ~ 246 a.a) partial recombinant protein. | 
| Immunogen sequence/protein sequence: | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI | 
| Protein accession: | AAH40261.1 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (26.73 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Applications: | ELISA,WB-Re | 
| Shipping condition: | Dry Ice |