Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 385,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 385,00 €
Data sheet of CD86 monoclonal antibody (M06), clone 1F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CD86 monoclonal antibody (M06), clone 1F6
| Brand: | Abnova |
| Reference: | H00000942-M06 |
| Product name: | CD86 monoclonal antibody (M06), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD86. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 942 |
| Gene name: | CD86 |
| Gene alias: | B7-2|B70|CD28LG2|LAB72|MGC34413 |
| Gene description: | CD86 molecule |
| Genbank accession: | BC040261.1 |
| Immunogen: | CD86 (AAH40261.1, 24 a.a. ~ 246 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI |
| Protein accession: | AAH40261.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |