CD80 monoclonal antibody (M37), clone 8D11 View larger

CD80 monoclonal antibody (M37), clone 8D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD80 monoclonal antibody (M37), clone 8D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CD80 monoclonal antibody (M37), clone 8D11

Brand: Abnova
Reference: H00000941-M37
Product name: CD80 monoclonal antibody (M37), clone 8D11
Product description: Mouse monoclonal antibody raised against a partial recombinant CD80.
Clone: 8D11
Isotype: IgG2b Kappa
Gene id: 941
Gene name: CD80
Gene alias: CD28LG|CD28LG1|LAB7
Gene description: CD80 molecule
Genbank accession: NM_005191.2
Immunogen: CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN
Protein accession: AAH11399.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000941-M37-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (12.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD80 monoclonal antibody (M37), clone 8D11 now

Add to cart