No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000941-M36 |
Product name: | CD80 monoclonal antibody (M36), clone 8B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD80. |
Clone: | 8B9 |
Isotype: | IgG1 Kappa |
Gene id: | 941 |
Gene name: | CD80 |
Gene alias: | CD28LG|CD28LG1|LAB7 |
Gene description: | CD80 molecule |
Genbank accession: | NM_005191.2 |
Immunogen: | CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN |
Protein accession: | AAH11399.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (12.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |