Cart 56 Product Products 19 932,48 € (empty)
-
1 x ANXA4-anne...121,50 € -
-
-
-
-
-
-
-
-
-
-
1 x WFDC11-WAP...113,40 € -
-
1 x Goat...409,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
19 932,48 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 56 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 19 932,48 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 19 932,48 €
Data sheet of CD80 monoclonal antibody (M20), clone 5G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CD80 monoclonal antibody (M20), clone 5G4
| Brand: | Abnova |
| Reference: | H00000941-M20 |
| Product name: | CD80 monoclonal antibody (M20), clone 5G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD80. |
| Clone: | 5G4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 941 |
| Gene name: | CD80 |
| Gene alias: | CD28LG|CD28LG1|LAB7 |
| Gene description: | CD80 molecule |
| Genbank accession: | NM_005191.2 |
| Immunogen: | CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN |
| Protein accession: | AAH11399.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (12.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |