| Brand:  | Abnova | 
| Reference:  | H00000941-M09 | 
| Product name:  | CD80 monoclonal antibody (M09), clone 5F5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CD80. | 
| Clone:  | 5F5 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 941 | 
| Gene name:  | CD80 | 
| Gene alias:  | CD28LG|CD28LG1|LAB7 | 
| Gene description:  | CD80 molecule | 
| Genbank accession:  | NM_005191.2 | 
| Immunogen:  | CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein. | 
| Immunogen sequence/protein sequence:  | SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN | 
| Protein accession:  | AAH11399.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (12.54 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |