Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 568,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 568,00 €
Data sheet of CD80 monoclonal antibody (M03A), clone 4A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about CD80 monoclonal antibody (M03A), clone 4A4
| Brand: | Abnova |
| Reference: | H00000941-M03A |
| Product name: | CD80 monoclonal antibody (M03A), clone 4A4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CD80. |
| Clone: | 4A4 |
| Isotype: | IgM Kappa |
| Gene id: | 941 |
| Gene name: | CD80 |
| Gene alias: | CD28LG|CD28LG1|LAB7 |
| Gene description: | CD80 molecule |
| Genbank accession: | NM_005191.2 |
| Immunogen: | CD80 (NP_005182.1, 1 a.a. ~ 288 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVN |
| Protein accession: | NP_005182.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.94 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CD80 transfected lysate using anti-CD80 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD80 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |