Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD80 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Human |
| Applications | WB,ELISA,SDS-PAGE,PI |
More info about CD80 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | H00000941-H02 |
| Product name: | CD80 (Human) Recombinant Protein |
| Product description: | Purified CD80 (AAH11399.2, 137 a.a. - 230 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
| Gene id: | 941 |
| Gene name: | CD80 |
| Gene alias: | CD28LG|CD28LG1|LAB7 |
| Gene description: | CD80 molecule |
| Genbank accession: | NM_005191.2 |
| Immunogen sequence/protein sequence: | SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN |
| Protein accession: | AAH11399.2 |
| Form: | Liquid |
| Concentration: | ≥ 10 ug/ml |
| Host cell: | Human HEK293T cells |
| Preparation method: | Transfection of pSuper-CD80 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
| Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | SDS-PAGE and Western Blot |
| Quality control testing picture: |  |
| Tag: | His-Flag-StrepII |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Applications: | WB,ELISA,SDS-PAGE,PI |
| Shipping condition: | Dry Ice |