Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of CD28 monoclonal antibody (M18), clone 4G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CD28 monoclonal antibody (M18), clone 4G11
| Brand: | Abnova |
| Reference: | H00000940-M18 |
| Product name: | CD28 monoclonal antibody (M18), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD28. |
| Clone: | 4G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 940 |
| Gene name: | CD28 |
| Gene alias: | MGC138290|Tp44 |
| Gene description: | CD28 molecule |
| Genbank accession: | NM_006139.3 |
| Immunogen: | CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
| Protein accession: | NP_006130.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |