Brand: | Abnova |
Reference: | H00000940-M03 |
Product name: | CD28 monoclonal antibody (M03), clone 1E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD28. |
Clone: | 1E5 |
Isotype: | IgG2b Kappa |
Gene id: | 940 |
Gene name: | CD28 |
Gene alias: | MGC138290|Tp44 |
Gene description: | CD28 molecule |
Genbank accession: | NM_006139.3 |
Immunogen: | CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
Protein accession: | NP_006130.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (17.05 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |