CD28 monoclonal antibody (M03), clone 1E5 View larger

CD28 monoclonal antibody (M03), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD28 monoclonal antibody (M03), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CD28 monoclonal antibody (M03), clone 1E5

Brand: Abnova
Reference: H00000940-M03
Product name: CD28 monoclonal antibody (M03), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant CD28.
Clone: 1E5
Isotype: IgG2b Kappa
Gene id: 940
Gene name: CD28
Gene alias: MGC138290|Tp44
Gene description: CD28 molecule
Genbank accession: NM_006139.3
Immunogen: CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Protein accession: NP_006130.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000940-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (17.05 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD28 monoclonal antibody (M03), clone 1E5 now

Add to cart