Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MS4A3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MS4A3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00000932-B01P |
| Product name: | MS4A3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MS4A3 protein. |
| Gene id: | 932 |
| Gene name: | MS4A3 |
| Gene alias: | CD20L|HTM4 |
| Gene description: | membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) |
| Genbank accession: | BC008487 |
| Immunogen: | MS4A3 (AAH08487, 1 a.a. ~ 214 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV |
| Protein accession: | AAH08487 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MS4A3 expression in transfected 293T cell line (H00000932-T01) by MS4A3 MaxPab polyclonal antibody. Lane 1: MS4A3 transfected lysate(23.65 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Human Eosinophils Express the High Affinity IgE Receptor, FcεRI, in Bullous Pemphigoid.Messingham KN, Holahan HM, Frydman AS, Fullenkamp C, Srikantha R, Fairley JA PLoS One. 2014 Sep 25;9(9):e107725. doi: 10.1371/journal.pone.0107725. eCollection 2014. |