| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00000930-M01A | 
| Product name: | CD19 monoclonal antibody (M01A), clone 1G3 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD19. | 
| Clone: | 1G3 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 930 | 
| Gene name: | CD19 | 
| Gene alias: | B4|MGC12802 | 
| Gene description: | CD19 molecule | 
| Genbank accession: | NM_001770 | 
| Immunogen: | CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD | 
| Protein accession: | NP_001761 | 
| Storage buffer: | In ascites fluid | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of CD19 expression in transfected 293T cell line by CD19 monoclonal antibody (M01A), clone 1G3. Lane 1: CD19 transfected lysate(61.1 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |