Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD5L monoclonal antibody (M01), clone 1C8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
More info about CD5L monoclonal antibody (M01), clone 1C8
| Brand: | Abnova |
| Reference: | H00000922-M01 |
| Product name: | CD5L monoclonal antibody (M01), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD5L. |
| Clone: | 1C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 922 |
| Gene name: | CD5L |
| Gene alias: | AIM|API6|PRO229|SP-ALPHA|Spalpha |
| Gene description: | CD5 molecule-like |
| Genbank accession: | BC033586 |
| Immunogen: | CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL |
| Protein accession: | AAH33586 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | CD5L is upregulated in hepatocellular carcinoma and promotes liver cancer cell proliferation and antiapoptotic responses by binding to HSPA5 (GRP78).Aran G, Sanjurjo L, Barcena C, Simon-Coma M, Tellez E, Vazquez-Vitali M, Garrido M, Guerra L, Diaz E, Ojanguren I, Elortza F, Planas R, Sala M, Armengol C, Sarrias MR. FASEB J. 2018 Feb 20:fj201700941RR. |