| Brand:  | Abnova | 
| Reference:  | H00000921-M13 | 
| Product name:  | CD5 monoclonal antibody (M13), clone 1F8 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CD5. | 
| Clone:  | 1F8 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 921 | 
| Gene name:  | CD5 | 
| Gene alias:  | LEU1|T1 | 
| Gene description:  | CD5 molecule | 
| Genbank accession:  | DQ892077 | 
| Immunogen:  | CD5 (ABM83003, 403 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL | 
| Protein accession:  | ABM83003 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.86 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | CD5 monoclonal antibody (M13), clone 1F8. Western Blot analysis of CD5 expression in K-562. | 
| Applications:  | WB-Ce,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |