Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD5 monoclonal antibody (M01), clone 2F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CD5 monoclonal antibody (M01), clone 2F7
| Brand: | Abnova |
| Reference: | H00000921-M01 |
| Product name: | CD5 monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD5. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 921 |
| Gene name: | CD5 |
| Gene alias: | LEU1|T1 |
| Gene description: | CD5 molecule |
| Genbank accession: | DQ892077 |
| Immunogen: | CD5 (ABM83003, 403 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL |
| Protein accession: | ABM83003 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CD5 expression in transfected 293T cell line by CD5 monoclonal antibody (M01), clone 2F7. Lane 1: CD5 transfected lysate (Predicted MW: 36.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |