Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD3Z monoclonal antibody (M01), clone 4A12-F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CD3Z monoclonal antibody (M01), clone 4A12-F6
| Brand: | Abnova |
| Reference: | H00000919-M01 |
| Product name: | CD3Z monoclonal antibody (M01), clone 4A12-F6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CD3Z. |
| Clone: | 4A12-F6 |
| Isotype: | IgG1 kappa |
| Gene id: | 919 |
| Gene name: | CD247 |
| Gene alias: | CD3-ZETA|CD3H|CD3Q|CD3Z|T3Z|TCRZ |
| Gene description: | CD247 molecule |
| Genbank accession: | BC025703 |
| Immunogen: | CD3Z (AAH25703, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Protein accession: | AAH25703 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CD3Z on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |